DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and CG34049

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001033871.2 Gene:CG34049 / 3885620 FlyBaseID:FBgn0054049 Length:306 Species:Drosophila melanogaster


Alignment Length:183 Identity:35/183 - (19%)
Similarity:61/183 - (33%) Gaps:44/183 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 ADRQVRQCDE-TGKFCANTDKYHYVATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQK 166
            ::|.:.:|.. ...||....|.::.:...:..::.|::|:.|.   |.||..|.......:|::|
  Fly    31 SNRDLEKCRSCLTSFCRKPIKIYHNSRNYLACEVQRSQSINSI---KSLPVKFPSTPNRSLNTEK 92

  Fly   167 LVPVREGTCVGHYMPLIQDHGSR-MGCGL---------RVKGRDEKESNIILLCHFS-------- 213
                            ...||.| :.|..         .::.:..|:....||..|.        
  Fly    93 ----------------DWSHGKRCLQCAAPKCKTSSRSSIQSKKLKKDKKSLLKEFEIYKIPIIR 141

  Fly   214 RASVNNLVPYEEGQIPAGKCATGPSQMYQFLCS-----EDEYVDANSMVVESN 261
            |..:...|..|..:......| .|.:|.:.|||     .|...|.|.:....|
  Fly   142 RKPIKQAVLRETNKYRRLHNA-NPLKMDEKLCSYAQEWADHLADLNKLETRPN 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 21/120 (18%)
CG34049NP_001033871.2 SCP_GAPR-1_like 146..272 CDD:240182 12/49 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455108
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.