DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and CG17974

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_611582.1 Gene:CG17974 / 37441 FlyBaseID:FBgn0034624 Length:259 Species:Drosophila melanogaster


Alignment Length:255 Identity:76/255 - (29%)
Similarity:103/255 - (40%) Gaps:31/255 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 LIPEDDPHCKPNLCMNSEIHVGC---------FQPKAVGEQCGKNNLFLNVNGALKTGILSRINM 72
            ::.:|...|.|:||.|...|:.|         .||.||.....::          |...|...|.
  Fly    18 ILAKDYSWCDPDLCGNGVRHIACRTTGNFHRRCQPDAVQVDVSRH----------KADFLHAHNK 72

  Fly    73 LRNYVASG-VGNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANTDKY-----HYVATTEI 131
            .||::|.| |..|..||||.||.||.|||.|:....|.|......|.||.:|     :..|....
  Fly    73 RRNFLALGKVPGYYPAARMATMVWDDELQYLSMLNTRTCKLDHDDCHNTYRYANSGQNLCAVWRP 137

  Fly   132 RSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVREGTCVGHYMPLIQDHGSRMGCGLRV 196
            ||......||....|.....|..| :....::|.|:.|:.|.  .||:..|..|....:||.:..
  Fly   138 RSPHVNVTSLVEECLGLWFNEFDL-IDSSFIDSFKVTPIFED--YGHFAELSVDKNFAVGCSIMR 199

  Fly   197 KGRDEKESNII--LLCHFSRASVNNLVPYEEGQIPAGKCATGPSQMYQFLCSEDEYVDAN 254
            ..|.:..|..|  .:|:::.........||.|: .|.:|.||.|..|..|||..|..|.|
  Fly   200 FTRPDYPSVYIYNFICNYASLYALGAPVYETGR-AASRCTTGKSHFYPGLCSTREVYDPN 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 49/157 (31%)
CG17974NP_611582.1 SCP_euk 63..218 CDD:240180 49/157 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440666
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.