DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and Glipr1l2

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_002729829.4 Gene:Glipr1l2 / 366890 RGDID:1310205 Length:228 Species:Rattus norvegicus


Alignment Length:283 Identity:55/283 - (19%)
Similarity:85/283 - (30%) Gaps:116/283 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKMWYLYLFLLPLTASL-----IPEDDPHCKPNLCMNSEIHVGCFQPKAVGEQCGKNNLFLNVNG 60
            :|:|...|:||.:::.|     :.||.......:.:::|:....|.|       |.|..|     
  Rat    24 LKLWLCELWLLLMSSGLNAKLPLEEDVDFINEYVNLHNELRGTVFPP-------GVNLRF----- 76

  Fly    61 ALKTGILSRINMLRNYVASGVGNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANT--DKY 123
                                            |.||..|.|.|....::|    .|..||  ||.
  Rat    77 --------------------------------MTWDVALSRTARAWGKKC----VFERNTHLDKV 105

  Fly   124 H--------------------YVATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLV 168
            |                    :.||..|||.....||....                        
  Rat   106 HESHPVFTDIGENMWVGPEKDFTATNAIRSWHEERKSYNYV------------------------ 146

  Fly   169 PVREGTCV-----GHYMPLIQDHGSRMGCGLRVKGRDEKESNI----ILLCHFSRASVNNLVPYE 224
               ..||:     .||:.|:.||..::||.:....   |...|    :.:|:::........||:
  Rat   147 ---NDTCIEDEDCSHYIQLVWDHSYKVGCAVTPCA---KVGAITYAALFICNYAPGGTLTRRPYQ 205

  Fly   225 EGQIPAGKCATGPSQMYQFLCSE 247
            .||. ..:| |...:...|||.:
  Rat   206 AGQF-CSRC-TNEEKCIDFLCGK 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 32/180 (18%)
Glipr1l2XP_002729829.4 CAP 51..197 CDD:412178 38/223 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344791
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.