DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and R3hdml

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001102432.1 Gene:R3hdml / 366245 RGDID:1305296 Length:253 Species:Rattus norvegicus


Alignment Length:192 Identity:43/192 - (22%)
Similarity:72/192 - (37%) Gaps:41/192 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 NYVASGVGNYSVAARMPTMGWDFELQRLADRQVRQC------DETGKFCANTDKYH---YVATTE 130
            |::.:.|  :..|:.|..|.||.:|.|.|:....||      .:..|:.......|   |.:..:
  Rat    71 NHIRASV--HPPASNMEYMVWDEQLARAAEAWATQCIWAHGPSQLTKYVGQNLSVHSGRYRSVVD 133

  Fly   131 IRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVREGTCVGHYMPLIQDHGSRMGC--- 192
            :.......|...|          |.....|..:...|.   .|....||..::....||:||   
  Rat   134 LVKSWSEEKRHYS----------FPAPKDCTPHCPWLC---SGPVCSHYTQMVWASSSRLGCAIH 185

  Fly   193 ---GLRVKGRDEKESNIILLCHFSRASVNNLV---PYEEGQIPAGKCATGPSQMYQFLCSED 248
               .:.|.|...::: :.|:|::  |...|.:   ||:.|: |...|.  ||  ||..|:.:
  Rat   186 TCSSINVWGSTWQQA-VYLVCNY--AIKGNWIGEAPYKTGK-PCSACP--PS--YQGNCNSN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 31/152 (20%)
R3hdmlNP_001102432.1 SCP 65..207 CDD:294090 31/151 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344644
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.