DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and Crisp2

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001011710.1 Gene:Crisp2 / 360445 RGDID:621653 Length:243 Species:Rattus norvegicus


Alignment Length:195 Identity:44/195 - (22%)
Similarity:72/195 - (36%) Gaps:47/195 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ILSRINMLRNYVASGVGN-----YSVAARMPTMGWD----FELQRLADRQVR-QCDETGKFCANT 120
            |:::.|.||..|:....|     ::|.|......|.    .|.....||::. :|.|  ....:|
  Rat    41 IIAKHNELRRQVSPPGSNILKMEWNVQAAANAQKWANNCILEHSSTEDRKINIKCGE--NLYMST 103

  Fly   121 DKYHYVATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVREGTCVGHYMPLIQD 185
            |...:  .|.|:|.....             |.|:..:|...||          .||||..|:..
  Rat   104 DPTSW--RTVIQSWYEEN-------------ENFVFGVGAKPNS----------AVGHYTQLVWY 143

  Fly   186 HGSRMGCGLRVKGRDEKESNIILLCHFSRASVNNLV----PYEEGQIPAGKCATGPSQMYQFLCS 246
            ...::|||: ....::.......:||:.... ||::    ||.:|.    .||:.|:.....||:
  Rat   144 SSFKVGCGV-AYCPNQDTLKYFYVCHYCPMG-NNVMKKSTPYHQGT----PCASCPNNCDNGLCT 202

  Fly   247  246
              Rat   203  202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 34/156 (22%)
Crisp2NP_001011710.1 CAP_CRISP 36..172 CDD:349402 34/158 (22%)
Crisp 189..243 CDD:400739 5/14 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344749
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.