DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and CG10651

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001286095.1 Gene:CG10651 / 35303 FlyBaseID:FBgn0032853 Length:316 Species:Drosophila melanogaster


Alignment Length:285 Identity:72/285 - (25%)
Similarity:117/285 - (41%) Gaps:42/285 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MWYLY--LFLLPLTASLIPEDDPHCKPNLCMNSEIHVGCFQPKAVGEQCGKN-NLFLNVNGALKT 64
            :|.|:  |::....||     |..||.:||...  ||.|.........|.|. ...:.::..:..
  Fly     5 IWLLFSTLYIQDTGAS-----DKWCKADLCRGQ--HVLCDDNGNFESTCPKQAAAMVKMSWDMIA 62

  Fly    65 GILSRINMLRNYVASGVGNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANTDKYHYVATT 129
            .|:.:.|..||..|.|:.....||||.|:.||.||.::||..||:|:.....||.|..|.:...:
  Fly    63 LIVDKHNEYRNKFAGGMDQNPKAARMTTIEWDPELAKVADGLVRRCEPIRDQCAITPNYGHAEVS 127

  Fly   130 EIRSKMGRTKSLKSAILDKL-----------LPELFLDVMGCMMNSQKLVPVREGTCVGHYMPLI 183
            ....|.....:.|.|:..:|           :.:||   .....|.|:|..        :|..::
  Fly   128 YSLEKYFCMTTKKEALRKQLDHWFDPNSKDEVQKLF---FSWTKNQQELSK--------NYFQVL 181

  Fly   184 QDHGSRMGCGLRVKGRDEKESNI---ILLCHFSRASVNNLVPYEE-GQIPAGKCATGPSQMYQFL 244
            :|..:|:||.:....|......:   :..|..|.....:...||: .:..|.:|..|.::.|:.|
  Fly   182 RDRANRVGCAIVEYVRPALVHQLLKCVYNCGVSLCEEEDNPVYEDTDEEAASECMKGSNKQYKNL 246

  Fly   245 CSEDEYV---DANSMVVESNMPSSD 266
            |.:||.|   :..|:.||   |.:|
  Fly   247 CHKDELVKTCNGGSLFVE---PEND 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 40/163 (25%)
CG10651NP_001286095.1 SCP_euk 61..210 CDD:240180 39/159 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440504
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.