DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and CLEC18A

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_016878695.1 Gene:CLEC18A / 348174 HGNCID:30388 Length:476 Species:Homo sapiens


Alignment Length:174 Identity:41/174 - (23%)
Similarity:66/174 - (37%) Gaps:36/174 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ILSRINMLRNYVASGVGNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANTDKYHYVATTE 130
            :||..|.||::|      ...||.|..:.|...|.:||..:...|.              ..|..
Human    51 LLSLHNRLRSWV------QPPAADMRRLDWSDSLAQLAQARAALCG--------------TPTPS 95

  Fly   131 IRSKMGRTKSLKSAILDKLLPE---LFLDVMGCMMNSQKLVP------VREGTCVGHYMPLIQDH 186
            :.|.:.||  |:.....:|||.   .|::|:.......:...      .|..||. ||..|:...
Human    96 LASGLWRT--LQVGWNMQLLPAGLVSFVEVVSLWFAEGQRYSHAAGECARNATCT-HYTQLVWAT 157

  Fly   187 GSRMGCGLRVKGRDEKESNIILLCHFSRAS--VN--NLVPYEEG 226
            .|::|||..:....:......:..:..|.:  ||  .:|||::|
Human   158 SSQLGCGRHLCSAGQAAIEAFVCAYSPRGNWEVNGKTIVPYKKG 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 34/155 (22%)
CLEC18AXP_016878695.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151061
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.