DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and Clec18a

DIOPT Version :10

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_038954172.1 Gene:Clec18a / 307851 RGDID:1559899 Length:497 Species:Rattus norvegicus


Alignment Length:247 Identity:57/247 - (23%)
Similarity:83/247 - (33%) Gaps:83/247 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYLFLLPLTASLIPEDDPHCKPNLCMNSEIHVGCFQPKAVG--EQCGKNNLFLNVNGALKTGILS 68
            |.|.||||......|..|   |.|            ||.|.  :...:...||         ||:
  Rat    40 LLLLLLPLLGITWTEVQP---PQL------------PKQVPIVQALSRKESFL---------ILT 80

  Fly    69 RINMLRNYVASGVGNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANTDKYHYVATTEIRS 133
            ..|.||:.|      :..||.|..|.|...|.:||..:...|..:             ||..:.:
  Rat    81 THNRLRSQV------HPSAANMQRMDWSESLAQLAQARAALCGTS-------------ATPNLAA 126

  Fly   134 KMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPV-----------REG--------TCVGHY 179
            .:..|            |::..:|....|.|...|.|           |.|        || .||
  Rat   127 TLRNT------------PDVGWNVQLLPMGSASFVEVVNVWFAEGLQYRHGSAECAHNATC-AHY 178

  Fly   180 MPLIQDHGSRMGCGLRVKGRDEKESNIILLCHFSRA---SVNN--LVPYEEG 226
            ..|:....|::|||.:....|:..:. ..:|.:|..   .:|.  :.||::|
  Rat   179 TQLVWATSSQLGCGWQPCFVDQVATE-AFVCAYSPGGNWEINGKMIAPYKKG 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 CAP_euk 63..213 CDD:349399 37/168 (22%)
Clec18aXP_038954172.1 CAP_euk 77..211 CDD:349399 38/175 (22%)
CLECT 361..485 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.