DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and Pi15

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001100387.1 Gene:Pi15 / 301489 RGDID:1309577 Length:258 Species:Rattus norvegicus


Alignment Length:225 Identity:49/225 - (21%)
Similarity:84/225 - (37%) Gaps:53/225 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 PKAVGEQCGKNNLFLNVNGALKTGILSRINMLRNYVASGVGNYSVAARMPTMGWDFELQRLADRQ 106
            |||      :...:::.|..:  .||...|.:|..|      :..||.|..|.||..|.:.|:..
  Rat    54 PKA------RRKRYISQNDMI--AILDYHNQVRGKV------FPPAANMEYMVWDENLAKSAEAW 104

  Fly   107 VRQC--DETGKFCANTDKYHYVATTEIRSKMGRTKSLKSAI---LDKLLPELFLDVMGCMMNSQK 166
            ...|  |....:...      .....:..:.||.:|:...:   .|::....|.....|    ..
  Rat   105 AATCIWDHGPSYLLR------FLGQNLSVRTGRYRSILQLVKPWYDEVKDYAFPYPQDC----NP 159

  Fly   167 LVPVREGTCVG----HYMPLIQDHGSRMGC------GLRVKGRDEKESNIILLCHFSRASVNNLV 221
            ..|:|   |.|    ||..::....:|:||      .:.|.|...:.: :.|:|::  |...|.:
  Rat   160 RCPMR---CFGPMCTHYTQMVWATSNRIGCAIHTCQNMNVWGSVWRRA-VYLVCNY--APKGNWI 218

  Fly   222 ---PYEEGQIPAGKCATGPSQMYQFLCSED 248
               ||:.| :|...|.  ||  |...|:::
  Rat   219 GEAPYKVG-VPCSSCP--PS--YGGACTDN 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 34/164 (21%)
Pi15NP_001100387.1 SCP_euk 69..212 CDD:240180 34/164 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344665
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.