DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and CG30486

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster


Alignment Length:264 Identity:81/264 - (30%)
Similarity:131/264 - (49%) Gaps:17/264 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MWYLYLFLLPLTASLIPEDDPHCKPNLCMNSEIHVGCFQPKAVGEQCGKNNLFLNVNGALKTGIL 67
            |.||...|:.:..|.......:|..:||:....|:.|.......|.||...:.:.....::..:|
  Fly     1 MLYLLSVLIIVLISQEALSTDYCNKDLCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAHLL 65

  Fly    68 SRINMLRNYVASG-VGNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANTDKYHYVATTEI 131
            :.:|..||.||.| ..:...|:||.|:.|..||..||...:|:||....:|:|||::.||:..  
  Fly    66 AVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSYI-- 128

  Fly   132 RSKMGRTKSLK-----SAILDKLLPELFLDVMGCMM---NSQKLVPVREGTCVGHYMPLIQDHGS 188
               .|.||.|:     .::||.:|.....||.||.|   |::|  |.::|.|.|::..|:||..:
  Fly   129 ---YGSTKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEK--PAKDGQCRGYFTQLVQDLAA 188

  Fly   189 RMGCGLRV-KGRDEKESNIILLCHFSRASVNNLVPYEEGQIPAGKCATGPSQMYQFLCSEDEYVD 252
            .:||.:.: ||:........:||||||..:.|.:.|.....|..:|..|...:|:.|||.:|:|:
  Fly   189 HVGCAMMLRKGQTSGLYQYGVLCHFSRGKIANELVYRASAHPGSRCYAGTHSIYEGLCSPEEHVN 253

  Fly   253 ANSM 256
            .|::
  Fly   254 PNAL 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 53/159 (33%)
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 53/159 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440701
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 1 1.000 - - H77274
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109749at50557
OrthoFinder 1 1.000 - - FOG0000453
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.800

Return to query results.
Submit another query.