powered by:
Protein Alignment antr and D2062.1
DIOPT Version :9
Sequence 1: | NP_001246284.1 |
Gene: | antr / 246647 |
FlyBaseID: | FBgn0050488 |
Length: | 272 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001293506.1 |
Gene: | D2062.1 / 24104374 |
WormBaseID: | WBGene00017055 |
Length: | 204 |
Species: | Caenorhabditis elegans |
Alignment Length: | 71 |
Identity: | 12/71 - (16%) |
Similarity: | 32/71 - (45%) |
Gaps: | 4/71 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 141 LKSAILDKLLPELFLDVMGCMMNSQKLVPVREGTCVGHYMPLIQDHGSRMGCGLRVKGRDEKESN 205
|...:...::...:::.:|...:|.|...::|. ||:..::.....::|.|:.: |:..:...
Worm 113 LPQTLAQAMVHLFYIEGIGYDYSSFKPELLKEN---GHFTQIVWKSSRKIGVGISI-GKSSQPPY 173
Fly 206 IILLCH 211
|..:.|
Worm 174 IPTMFH 179
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.