DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and Crisp2

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001191000.1 Gene:Crisp2 / 22024 MGIID:98815 Length:243 Species:Mus musculus


Alignment Length:264 Identity:50/264 - (18%)
Similarity:90/264 - (34%) Gaps:85/264 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 WY---LYLFLLPLTASLIPEDDPHCKPNLCMNSEIHVGCFQPKAVGEQCGKNNLFLNVNGALKTG 65
            |:   |::|.|.|.:.|....||.....|....::                           :..
Mouse     3 WFQVMLFVFALLLRSPLTEGKDPDFTSLLTNQLQV---------------------------QRE 40

  Fly    66 ILSRINMLRNYVASGVGNYSVAARMPT------MGWDFELQRLADRQVRQC--DETGKFCANTDK 122
            |:::.|.||..|            .||      |.|..:....|.:...:|  :.:.|    .|:
Mouse    41 IVNKHNELRRSV------------NPTGSDILKMEWSIQATTNAQKWANKCILEHSSK----DDR 89

  Fly   123 YHYVATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQK----LVPVREGTCVGHYMPLI 183
                   :|..:.|....:.:.      |.|:..|:....|..:    .|..:..:.||||..|:
Mouse    90 -------KINIRCGENLYMSTD------PTLWSTVIQSWYNENEDFVYGVGAKPNSAVGHYTQLV 141

  Fly   184 QDHGSRMGCGLRVKGRDEKESNI--ILLCHFSRASVNNLV----PYEEGQIPAGKCATGPSQMYQ 242
            .....::|||:   .....:.|:  ..:||:.... ||::    ||::|.    .||:.|:....
Mouse   142 WYSSFKIGCGI---AYCPNQDNLKYFYVCHYCPMG-NNVMKKSTPYQQGT----PCASCPNNCEN 198

  Fly   243 FLCS 246
            .||:
Mouse   199 GLCT 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 31/163 (19%)
Crisp2NP_001191000.1 SCP_CRISP 36..171 CDD:240183 31/193 (16%)
Crisp 189..243 CDD:285731 5/14 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841352
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.