DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and scl-21

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_507793.1 Gene:scl-21 / 189870 WormBaseID:WBGene00012816 Length:198 Species:Caenorhabditis elegans


Alignment Length:217 Identity:45/217 - (20%)
Similarity:74/217 - (34%) Gaps:80/217 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ILSRINMLRNYVAS--------GVGNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANTDK 122
            |::.||.||:.|||        .|.....|:.|..|.|:..|...|.:..:.|            
 Worm    26 IVTYINDLRSLVASRRFHLDSRDVETLPPASDMLKMTWNSTLAVAAQKLAKTC------------ 78

  Fly   123 YHYVATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVREGTCVGHY-------- 179
              ::|          .:|....|.||.:.            :..:|.|.: ..:||:        
 Worm    79 --FIA----------VESSSPGIADKRIV------------AANVVTVAK-NALGHWKHSLNKEW 118

  Fly   180 -----------MPLIQDHGSRMGCGL---RVKGRDEKESNIILLCHF-SRASVNNLVPYEEGQ-- 227
                       :.||....|.:|||.   .:..:..:...::  |.| .:..:.....|::|:  
 Worm   119 NLKSYNSNYIGIQLIWAKSSSVGCGFSPCEIDSQGRRWYKVV--CSFEKKGGITREPVYKKGKAC 181

  Fly   228 --IPAG-KCATGPSQMYQFLCS 246
              .||| |||:|     ..|||
 Worm   182 EACPAGTKCASG-----SVLCS 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 33/177 (19%)
scl-21NP_507793.1 CAP_euk 23..163 CDD:349399 32/175 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.870

Return to query results.
Submit another query.