DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and scl-25

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_507364.1 Gene:scl-25 / 188600 WormBaseID:WBGene00011841 Length:212 Species:Caenorhabditis elegans


Alignment Length:266 Identity:53/266 - (19%)
Similarity:90/266 - (33%) Gaps:83/266 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYLFLLPLTASLIPEDDPHCKPNLCMNSEIHVGCFQPKAVGEQCGKNNLFLNVNGALKTGILSRI 70
            |.:.||.|||:  ...|.|..|....|:|         |:     .|.:|::             
 Worm     3 LIILLLALTAA--AHADRHFNPQHRWNAE---------AI-----DNIVFIH------------- 38

  Fly    71 NMLRNYVASGV---GNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANTDK---------- 122
            |.|||..:.|:   .:.|.::.|..:.|:..|       |.:.:....:|...|.          
 Worm    39 NKLRNAASHGLWERHSISKSSNMQLLSWNESL-------VAEAENEKYYCEPADNKNLPIKLGDN 96

  Fly   123 -YHY-VATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVREGTCVGHYMPLIQD 185
             |.| |.|.:....:|...|:.....|.|..|                   ..........::..
 Worm    97 IYQYDVNTYDDIDGVGAMGSINKDTHDALKSE-------------------AKAAKNRLRQMLYS 142

  Fly   186 HGSRMGCGLRVKGR-DEKESNI---ILLCHFSRASVNNLVP--YEEGQ----IPAG-KCATGPSQ 239
            ....:||......: |.|..|.   :|:|.:| ..:.|:..  :::|:    .|:| .|.|.|::
 Worm   143 KSKSIGCIYESCDKIDSKGINYNTRLLICKYS-PPLENIDEKLFDKGEPCSNCPSGTSCGTDPNE 206

  Fly   240 MYQFLC 245
            |.: ||
 Worm   207 MMK-LC 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 28/168 (17%)
scl-25NP_507364.1 CAP_euk 31..174 CDD:349399 30/186 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.