Sequence 1: | NP_001246284.1 | Gene: | antr / 246647 | FlyBaseID: | FBgn0050488 | Length: | 272 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_502228.2 | Gene: | scl-18 / 188436 | WormBaseID: | WBGene00011724 | Length: | 225 | Species: | Caenorhabditis elegans |
Alignment Length: | 199 | Identity: | 42/199 - (21%) |
---|---|---|---|
Similarity: | 73/199 - (36%) | Gaps: | 34/199 - (17%) |
- Green bases have known domain annotations that are detailed below.
Fly 66 ILSRINMLRNYVASGVGNY--------SVAARMPTMGWDFELQRLADRQVRQCDETGKFCANTDK 122
Fly 123 ---YHYVATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVREGTCVGHYMPLIQ 184
Fly 185 DHGSRMGCGL-------RVKGRDEKESNIILLCHF-SRASVNNLVPYEEGQIPAGKCATGPSQMY 241
Fly 242 QFLC 245 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
antr | NP_001246284.1 | SCP_euk | 63..213 | CDD:240180 | 33/165 (20%) |
scl-18 | NP_502228.2 | SCP | 37..193 | CDD:214553 | 33/165 (20%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 41 | 1.000 | Domainoid score | I8510 |
eggNOG | 1 | 0.900 | - | - | E1_COG2340 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 71 | 1.000 | Inparanoid score | I3895 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.870 |