DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and F58E2.5

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_500349.1 Gene:F58E2.5 / 186521 WormBaseID:WBGene00019049 Length:232 Species:Caenorhabditis elegans


Alignment Length:220 Identity:44/220 - (20%)
Similarity:78/220 - (35%) Gaps:65/220 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LFLNVNGAL-KTGILSRINMLRNYVASGVGNYSV-----------AARMPTMGWDFELQRLADRQ 106
            ||||:..|: ...||:..|.||:.:|:|.....:           ||.|..:.|:..|..||...
 Worm    30 LFLNLASAIAHKDILNAYNNLRSEIANGTFTMKLQFPDITIPLAPAAGMLKLKWNCRLAALAQAY 94

  Fly   107 VRQCDETGKFCANTDK----YHYVATTEIRSKMGRTKSLKSAILDKLLPE---LFLDVMGCMMNS 164
            |..|........:..|    |.::           ..:|:..|.|.:|..   |.:|.....:|.
 Worm    95 VDSCPSYQDLRVHKPKFPVTYSFL-----------DANLQEHIKDPVLYRFKILEMDFRRGYIND 148

  Fly   165 ---QKLVPVREGTCVGHYMPLIQDHGSRMGCGLRVKGRDEKESNIILLCHFSRASVNNLVPYEEG 226
               :||:..:.                 :||..     :....|::.:|::....      ||:.
 Worm   149 DWFKKLISSKS-----------------IGCAF-----NNCSENVLFVCYYKEQI------YEDF 185

  Fly   227 QIPAGKCATGPSQMYQFLCSEDEYV 251
            :.|    ..|.::..:|:...|:||
 Worm   186 KFP----VNGGAEPGRFIKELDDYV 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 31/170 (18%)
F58E2.5NP_500349.1 CAP_euk 40..177 CDD:349399 31/169 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.