powered by:
Protein Alignment antr and F57B7.2
DIOPT Version :9
Sequence 1: | NP_001246284.1 |
Gene: | antr / 246647 |
FlyBaseID: | FBgn0050488 |
Length: | 272 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001367203.1 |
Gene: | F57B7.2 / 186438 |
WormBaseID: | WBGene00010192 |
Length: | 330 |
Species: | Caenorhabditis elegans |
Alignment Length: | 35 |
Identity: | 9/35 - (25%) |
Similarity: | 17/35 - (48%) |
Gaps: | 1/35 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 204 SNIILLCHFSRASVNNLVPYE-EGQIPAGKCATGP 237
:|.:.:..|.|.:.|:..|.| ...:|:..|:..|
Worm 272 NNCVAVVCFYRPAGNSNAPGEFASNVPSRDCSMSP 306
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.