DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and scl-11

DIOPT Version :10

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_502499.1 Gene:scl-11 / 186050 WormBaseID:WBGene00009892 Length:207 Species:Caenorhabditis elegans


Alignment Length:114 Identity:27/114 - (23%)
Similarity:43/114 - (37%) Gaps:38/114 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 WQGLQHEIEDHLAKGHKELGEVFRFRESTSLVFKEQISLGGLKLVDAFSKRFLFYFFSDVAHKKL 150
            |...|.:|.||              ..|.|:|.:|::|: .|:|.||..:........|...|::
 Worm   239 WLPFQCDISDH--------------DYSLSVVGEEKLSV-VLQLKDAPRREIWITNKMDDETKEM 288

  Fly   151 SFLMLYFGRREEAAQYCYELEI-------SGRPVF----SRTVKFVERC 188
            |:..|            :|:|:       ||||..    .:.|...|:|
 Worm   289 SWRKL------------FEVEVGTRYYMWSGRPFLVDEEKKIVVCCEKC 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 CAP_euk 63..213 CDD:349399 27/114 (24%)
scl-11NP_502499.1 SCP 21..173 CDD:214553
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.