DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and scl-23

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_499859.3 Gene:scl-23 / 182028 WormBaseID:WBGene00015246 Length:330 Species:Caenorhabditis elegans


Alignment Length:239 Identity:49/239 - (20%)
Similarity:88/239 - (36%) Gaps:77/239 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LNVNGALKTGILSRINMLRNYVASGVGNYSV-------AARMPTMGWDFELQRLADRQVRQC--- 110
            ||:...|:..||.:.|.:|:.||  :|.|:|       |..|..:.||.||:..|.::.:||   
 Worm   115 LNLPARLQNLILDKHNEIRSQVA--LGQYAVDDDYLPPADNMVKLDWDCELELEAQQRAQQCNLQ 177

  Fly   111 -DETGKFCANTDKYH-----YVATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNS----- 164
             :.:|:.....|:..     |..||:                       .|||.|.::..     
 Worm   178 KENSGRQMNGWDEVRGENAFYFRTTD-----------------------GLDVSGAVLKGIQRMG 219

  Fly   165 --------QKLVPVREGTCVGHYMPLIQDHGSRMGCGL-----RVKGRDEKESNIILLCHFSRAS 216
                    :.|...|..:.:||...::.....::||.:     |..|..:.:...:.:|.:    
 Worm   220 DEIAIAGIKNLKLSRYDSRIGHATQILWKETRKLGCAVQECPARQDGSLDGQKYNVAVCKY---- 280

  Fly   217 VNNLVPYEEGQIPAGKCATGPSQMYQF-----LCSEDEYVDANS 255
                  |..|.:  .|.:| |:.:|..     .|||..:.|.::
 Worm   281 ------YPTGNV--FKSST-PTSIYSVGDVASACSEGTFGDPST 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 36/183 (20%)
scl-23NP_499859.3 CAP_euk 122..281 CDD:349399 36/193 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157347
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.760

Return to query results.
Submit another query.