DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and scl-13

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_504055.1 Gene:scl-13 / 178798 WormBaseID:WBGene00019179 Length:208 Species:Caenorhabditis elegans


Alignment Length:246 Identity:53/246 - (21%)
Similarity:88/246 - (35%) Gaps:81/246 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 GC----FQPKAVGEQCGKNNLFLNVNGALKTGILSRINMLRNYVASGVGNYSVAARMPTMGWDFE 98
            ||    |...|.|:....:|   .:..|:..|         :|||:|....| |:.|..:.||..
 Worm    12 GCATAQFSSTAQGQIVDAHN---KLRSAIAQG---------SYVAAGTQEPS-ASNMRKIVWDET 63

  Fly    99 LQRLADRQVRQC--DETG-------------KFCANTDKYHYVATTEIRS---KMGRTKSLKSAI 145
            :...|......|  |.:|             ...::.||:...|:....|   |.|.|.:     
 Worm    64 VAAAAQEYAEGCPDDHSGTSYGENLYWSWSSSAPSSLDKFGVAASNSWESEFQKYGWTST----- 123

  Fly   146 LDKLLPELFLDVMGCMMNSQKLVPVREGTCVGHYMPLIQDHGSRMGCGLRVKGRDEKESN---II 207
                    |||..|.            .|.:||...:.....|::|||::..|:|..:.|   :.
 Worm   124 --------FLDEAGF------------ATGIGHATQMAWAETSKIGCGIKNCGKDANKKNMYKVA 168

  Fly   208 LLCHFSRASVNNLVP---YEEGQIPAGKCATGPSQMYQFLCSEDEYVDANS 255
            ::|.:.  |..|::.   |::|:    .|:.         ||||...:.:|
 Worm   169 VVCQYD--SAGNMMDSDIYQQGE----TCSA---------CSEDASCEQDS 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 36/170 (21%)
scl-13NP_504055.1 SCP 21..174 CDD:214553 40/190 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 71 1.000 Inparanoid score I3895
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.870

Return to query results.
Submit another query.