DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and CRISP1

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001122.2 Gene:CRISP1 / 167 HGNCID:304 Length:249 Species:Homo sapiens


Alignment Length:221 Identity:45/221 - (20%)
Similarity:65/221 - (29%) Gaps:79/221 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 NMLRNYVASGVGNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANTDKYHYVATTEIRSKM 135
            |.||..|.....|      |..|.|..|..:.|....:.||.|                      
Human    49 NALRRRVVPPASN------MLKMSWSEEAAQNARIFSKYCDMT---------------------- 85

  Fly   136 GRTKSLKSAILDKLLPELFLDVMGCMMNSQKL-VPVREGTCVG---------------------- 177
                  :|..|::.||..|     |..|.... .||...:.:|                      
Human    86 ------ESNPLERRLPNTF-----CGENMHMTSYPVSWSSVIGVWYSESTSFKHGEWTTTDDDIT 139

  Fly   178 --HYMPLIQDHGSRMGCGLRVKGRDEKESNIILLCHF----SRASVNNLVPYEEGQIPAGKCATG 236
              ||..::......:||.: ...|.:.....:.:||:    :.....| .||:.| :|...|   
Human   140 TDHYTQIVWATSYLIGCAI-ASCRQQGSPRYLYVCHYCHEGNDPETKN-EPYKTG-VPCEAC--- 198

  Fly   237 PSQMYQFLCSE-----DEYVDANSMV 257
            ||.....||:.     |||.|.:..|
Human   199 PSNCEDKLCTNPCIYYDEYFDCDIQV 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 30/170 (18%)
CRISP1NP_001122.2 SCP_CRISP 39..177 CDD:240183 30/167 (18%)
Crisp 195..249 CDD:285731 10/33 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151254
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.