DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and CG43777

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001261163.1 Gene:CG43777 / 14462631 FlyBaseID:FBgn0264299 Length:273 Species:Drosophila melanogaster


Alignment Length:276 Identity:70/276 - (25%)
Similarity:103/276 - (37%) Gaps:53/276 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 MWYLYL---FLLPLTASLIPEDDPHCKPNLCMNSEIHVGCFQPKAVGEQC--------GKNNLF- 55
            ||.|.|   .|||||:..          |.| |::.| .|...|.....|        |.:..| 
  Fly     2 MWRLLLAVVLLLPLTSGY----------NYC-NNKTH-KCVLEKKKHFMCHLKDFTVYGNSTKFH 54

  Fly    56 --LNVNGALKTGILSRINMLRNYVASG----VGN--YSVAARMPTMGWDFELQRLADRQVRQCDE 112
              :..|..::...|..:|.|||..|.|    .||  ::.|.||..:.||.||..:.:........
  Fly    55 ASVPNNMRMQKIALDILNNLRNKFAGGELRTKGNKTFAKARRMRQLFWDKELAYMGNNHASTLSL 119

  Fly   113 TGKFCANTDKYHYV----ATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLV----P 169
            ....|.:|.::.:|    |....|.|:    :||. |..|....:|.:... :.:...|:    |
  Fly   120 KSSQCRSTLRFPHVGEAIALVTPREKL----NLKE-IYSKAFTPMFAEYQH-VSDPDALLHAFDP 178

  Fly   170 VREGTCVGHYMPLIQDHGSRMGCGLRVKGRDEKESNI--ILLCHFSRASVNNLVPYEEGQIPAGK 232
            .|:.. |.|:..:|.|..||:|||:.|..........  .|.|:|...::.....|:.|. |...
  Fly   179 DRDFQ-VRHFTNIISDRVSRVGCGVAVGANCNPSIKFCHFLTCYFDFHNMAGSYVYKAGD-PTSS 241

  Fly   233 C---ATGPSQMYQFLC 245
            |   ....|..|..||
  Fly   242 CDDWGVVSSDKYANLC 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 42/165 (25%)
CG43777NP_001261163.1 SCP_euk 64..223 CDD:240180 42/165 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45440509
Domainoid 1 1.000 41 1.000 Domainoid score I8510
eggNOG 1 0.900 - - E1_COG2340
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.