DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and Crisp1

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_033768.3 Gene:Crisp1 / 11571 MGIID:102553 Length:244 Species:Mus musculus


Alignment Length:269 Identity:54/269 - (20%)
Similarity:97/269 - (36%) Gaps:81/269 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LYLFLLPLTASLIPEDDPHCKPNLCMNSEIHVGCFQPKAVGEQCGKNNLFLNVNGALKTGILSRI 70
            |.||.|   |:::|       |:|..:|             .|..:.........:::..|:|:.
Mouse     5 LVLFFL---AAVLP-------PSLLQDS-------------SQENRLEKLSTTKMSVQEEIVSKH 46

  Fly    71 NMLRNYVA-SGVGNYSVAARMPTMGWDFE----LQRLADRQVRQCDETGKFCANTDKYHYVATTE 130
            |.||..|: ||       :.:..|.|:::    .|:.||:           |..:.....:.||.
Mouse    47 NQLRRMVSPSG-------SDLLKMEWNYDAQVNAQQWADK-----------CTFSHSPIELRTTN 93

  Fly   131 IRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLV----PVREGTCVGHYMPLIQDHGSRMG 191
            :|..       ::..:...|......:.|.....:.|.    |.:..:.||||..::.:...::.
Mouse    94 LRCG-------ENLFMSSYLASWSSAIQGWYNEYKDLTYDVGPKQPDSVVGHYTQVVWNSTFQVA 151

  Fly   192 CGLRVKGRDEKESNII---LLCHFSRASVNN-----LVPYEEGQIPAGKCATGPSQMYQFLCS-- 246
            ||:.     |...|.:   .:||:  ..|.|     ..||..|:    .||:.|......||:  
Mouse   152 CGVA-----ECPKNPLRYYYVCHY--CPVGNYQGRLYTPYTAGE----PCASCPDHCEDGLCTNS 205

  Fly   247 ---EDEYVD 252
               ||:|.:
Mouse   206 CGHEDKYTN 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 31/161 (19%)
Crisp1NP_033768.3 SCP_CRISP 37..172 CDD:240183 31/166 (19%)
Crisp 190..244 CDD:285731 8/25 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841439
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.