powered by:
Protein Alignment antr and CG42713
DIOPT Version :9
Sequence 1: | NP_001246284.1 |
Gene: | antr / 246647 |
FlyBaseID: | FBgn0050488 |
Length: | 272 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001188736.1 |
Gene: | CG42713 / 10178890 |
FlyBaseID: | FBgn0261630 |
Length: | 92 |
Species: | Drosophila melanogaster |
Alignment Length: | 58 |
Identity: | 10/58 - (17%) |
Similarity: | 18/58 - (31%) |
Gaps: | 27/58 - (46%) |
- Green bases have known domain annotations that are detailed below.
Fly 2 KMWYLYLFLLPLTASLIPEDDPHCKPNLCMNSEIHVGCFQPKAVGEQCGKNNLFLNVN 59
:|||. :.:.|.|:... ::|| .|..|.:..:|
Fly 52 QMWYY-----------------NQRENRCIKMR-YLGC---------KGNRNRYCTLN 82
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
antr | NP_001246284.1 |
SCP_euk |
63..213 |
CDD:240180 |
|
CG42713 | NP_001188736.1 |
KU |
<54..89 |
CDD:294074 |
9/56 (16%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG2340 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.