DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and LOC100536500

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_017207056.1 Gene:LOC100536500 / 100536500 -ID:- Length:245 Species:Danio rerio


Alignment Length:211 Identity:44/211 - (20%)
Similarity:78/211 - (36%) Gaps:50/211 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 FLNVNGALK-TGILSRINMLRNYVASGVGN------YSVAARMPTMGWDFELQRLADRQVRQCDE 112
            ||:::.|.. ||:.:.::.::..:.. |.|      ...|:.|..|.|...:...|...:.:|:.
Zfish    20 FLHMSAACSVTGVCTELSSVQQEIVD-VHNAFRRAVQPSASNMLKMSWSDAVAESARGWINKCNM 83

  Fly   113 TGKFCANTDKYHYVATTEIRS--KMGRT-------KSLKSAILDKLLPELFLDVMGCMMNSQKLV 168
            |          |...::.:.:  :||..       .|..|.:          |.....:|:.| .
Zfish    84 T----------HGPPSSRMLNGYEMGENLFKATGISSWTSVV----------DAWHSEVNNYK-Y 127

  Fly   169 PVR--EGTCVGHYMPLIQDHGSRMGCGLRVKGRDEKESNIILLCHFSRA-SVNNLVPYEEGQIPA 230
            |:.  .|...|||..::......:||.:...|     ||....||:.|| :...:.||..|    
Zfish   128 PIGSINGQATGHYTQVVWYSSYEVGCAVTQCG-----SNYFYGCHYYRAGNFRTVPPYSLG---- 183

  Fly   231 GKCATGPSQMYQFLCS 246
            ..||:.|:.....||:
Zfish   184 SPCASCPNNCEDNLCT 199

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 31/167 (19%)
LOC100536500XP_017207056.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585624
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.