Sequence 1: | NP_001246284.1 | Gene: | antr / 246647 | FlyBaseID: | FBgn0050488 | Length: | 272 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_003199065.1 | Gene: | crispld2 / 100535149 | ZFINID: | ZDB-GENE-130131-1 | Length: | 508 | Species: | Danio rerio |
Alignment Length: | 201 | Identity: | 50/201 - (24%) |
---|---|---|---|
Similarity: | 75/201 - (37%) | Gaps: | 45/201 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 66 ILSRINMLRNYVASGVGNYSVAARMPTMGWDFELQRLADRQVRQCD-ETG----------KFCAN 119
Fly 120 TDKYHYVATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVR-EGTCVGHYMPLI 183
Fly 184 QDHGSRMGCGLRVKGR-----DEKESNIILLCHFS-RASVNNLVPYEEGQIPAGKCATGPSQMYQ 242
Fly 243 FLCSED 248 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
antr | NP_001246284.1 | SCP_euk | 63..213 | CDD:240180 | 40/163 (25%) |
crispld2 | XP_003199065.1 | SCP_euk | 61..206 | CDD:240180 | 40/163 (25%) |
LCCL | 299..382 | CDD:128866 | |||
LCCL | 402..495 | CDD:281766 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170585807 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2340 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.750 |