DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and crispld2

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_003199065.1 Gene:crispld2 / 100535149 ZFINID:ZDB-GENE-130131-1 Length:508 Species:Danio rerio


Alignment Length:201 Identity:50/201 - (24%)
Similarity:75/201 - (37%) Gaps:45/201 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ILSRINMLRNYVASGVGNYSVAARMPTMGWDFELQRLADRQVRQCD-ETG----------KFCAN 119
            ||...|.||..|      |..|:.|..|.||.||:|.|.....||. |.|          ....:
Zfish    64 ILKLHNKLRGEV------YPTASNMEYMIWDDELERSATSWAEQCQWEHGPQDLLMSIGQNLAVH 122

  Fly   120 TDKYHYVATTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVR-EGTCVGHYMPLI 183
            ..:|        ||.....::....:.|...|........|        |.| .|....||..|:
Zfish   123 WGRY--------RSPAYHVQAWYDEVKDYTYPYPHECNPWC--------PERCSGPMCTHYTQLV 171

  Fly   184 QDHGSRMGCGLRVKGR-----DEKESNIILLCHFS-RASVNNLVPYEEGQIPAGKCATGPSQMYQ 242
            ....:|:||.:.|..|     :..|:.:.|:|::| :.:.....||:.|: |..:|.  ||  |.
Zfish   172 WATTNRVGCAVHVCPRMNVWGEIWENAVYLVCNYSPKGNWIGEAPYQHGR-PCSQCP--PS--YG 231

  Fly   243 FLCSED 248
            .:|.::
Zfish   232 GVCRDN 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 40/163 (25%)
crispld2XP_003199065.1 SCP_euk 61..206 CDD:240180 40/163 (25%)
LCCL 299..382 CDD:128866
LCCL 402..495 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585807
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.