powered by:
Protein Alignment antr and LOC100497187
DIOPT Version :9
Sequence 1: | NP_001246284.1 |
Gene: | antr / 246647 |
FlyBaseID: | FBgn0050488 |
Length: | 272 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_017945658.1 |
Gene: | LOC100497187 / 100497187 |
-ID: | - |
Length: | 208 |
Species: | Xenopus tropicalis |
Alignment Length: | 39 |
Identity: | 9/39 - (23%) |
Similarity: | 15/39 - (38%) |
Gaps: | 8/39 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 177 GHYMPLIQDHGSRMGCGLR--------VKGRDEKESNII 207
||:..::......:|.|:. |.||.....|:|
Frog 159 GHFTQVVWKDSKELGVGVATDGKGTFYVVGRYSPPGNVI 197
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
antr | NP_001246284.1 |
SCP_euk |
63..213 |
CDD:240180 |
9/39 (23%) |
LOC100497187 | XP_017945658.1 |
None |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1528782at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.