DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and crispld1

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_002937123.2 Gene:crispld1 / 100490431 XenbaseID:XB-GENE-989389 Length:514 Species:Xenopus tropicalis


Alignment Length:237 Identity:55/237 - (23%)
Similarity:82/237 - (34%) Gaps:70/237 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 ILSRINMLRNYVASGVGNYSVAARMPTMGWDFELQRLADRQVRQC------------------DE 112
            ||...|.||..|      |..|:.|..|.||.||:|.|:.....|                  ..
 Frog    65 ILDLHNKLRGEV------YPPASNMEFMIWDVELERSAEAWAETCLWEHGPADLLPVIGQNLGAH 123

  Fly   113 TGKFCANTDKYHYVA-TTEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVREGTCV 176
            .|::...|  ||..| ..|:|              |...|           ..|:..|.....|.
 Frog   124 WGRYRPPT--YHVQAWYDEVR--------------DYTFP-----------YPQECDPYCPFRCS 161

  Fly   177 G----HYMPLIQDHGSRMGC------GLRVKGRDEKESNIILLCHFS-RASVNNLVPYEEGQIPA 230
            |    ||..|:....||:||      .:.|.|:...:: |.|:|::| :.:.....||:.|. |.
 Frog   162 GPVCTHYTQLVWATSSRIGCAINLCHNMNVWGQIWPKA-IYLVCNYSPKGNWWGHAPYKHGH-PC 224

  Fly   231 GKCATGPSQMYQFLCSEDE-YVDANSMVVESNMPSSDQIQVD 271
            ..|.  ||  |...|.::. |.|.:.:......|..:..:::
 Frog   225 SACP--PS--YGGGCKDNLCYKDGSDLHYPLPEPEEETNEIE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 42/175 (24%)
crispld1XP_002937123.2 CAP_CRISPLD1 62..207 CDD:349407 42/175 (24%)
LCCL 304..388 CDD:128866
LCCL 407..506 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.