DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and XB5812873

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:XP_031758624.1 Gene:XB5812873 / 100127722 XenbaseID:XB-GENE-5812874 Length:272 Species:Xenopus tropicalis


Alignment Length:296 Identity:57/296 - (19%)
Similarity:73/296 - (24%) Gaps:156/296 - (52%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 NNL--FLNVNGAL------------------------KTGILSRINML---RNYVASGVGNYSVA 87
            :||  ||.:||.|                        .|.:.|..|.:   .||..|.|.  ..|
 Frog    23 HNLSSFLEMNGFLLLLCLASLSKPTSEQDSVESFDEMSTDLESNRNFIVDKHNYYRSWVN--PPA 85

  Fly    88 ARMPTMGWD---------------FELQRLADRQVRQCDETGKFCANT-------DKYHYVAT-- 128
            |.|..|.||               |:...|:.||.     .|:|....       ..:.||..  
 Frog    86 ADMLKMHWDNYYLAKAKEWALTCSFKHSNLSFRQY-----GGEFAGENIMNSYFRHSWEYVINYW 145

  Fly   129 ----TEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVREGTCVGHYMPLI--QDH- 186
                ......:|.||                                ||...||:..:|  ..| 
 Frog   146 FNEHVNWEYAVGTTK--------------------------------EGAVTGHFTQIIWAPTHA 178

  Fly   187 ------------------------GSR-----------MGCGLRVKGRDEKESNIILLCHFSRAS 216
                                    |:|           ..|||..|..|::      ||      
 Frog   179 LACYVAKCYGTPYNYFYVCIYYPTGNREDKVKTPYQNGTTCGLCQKDCDDQ------LC------ 231

  Fly   217 VNNLVPYEEGQIPAGKCATGPSQMYQFLCSEDEYVD 252
             .|..||...   ||.|.|..:..   ||   :|.|
 Frog   232 -LNYCPYYNS---AGNCGTDKNAS---LC---DYSD 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 39/218 (18%)
XB5812873XP_031758624.1 CAP 65..201 CDD:412178 29/174 (17%)
Crisp 219..269 CDD:400739 18/61 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.