Sequence 1: | NP_001246284.1 | Gene: | antr / 246647 | FlyBaseID: | FBgn0050488 | Length: | 272 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031758624.1 | Gene: | XB5812873 / 100127722 | XenbaseID: | XB-GENE-5812874 | Length: | 272 | Species: | Xenopus tropicalis |
Alignment Length: | 296 | Identity: | 57/296 - (19%) |
---|---|---|---|
Similarity: | 73/296 - (24%) | Gaps: | 156/296 - (52%) |
- Green bases have known domain annotations that are detailed below.
Fly 52 NNL--FLNVNGAL------------------------KTGILSRINML---RNYVASGVGNYSVA 87
Fly 88 ARMPTMGWD---------------FELQRLADRQVRQCDETGKFCANT-------DKYHYVAT-- 128
Fly 129 ----TEIRSKMGRTKSLKSAILDKLLPELFLDVMGCMMNSQKLVPVREGTCVGHYMPLI--QDH- 186
Fly 187 ------------------------GSR-----------MGCGLRVKGRDEKESNIILLCHFSRAS 216
Fly 217 VNNLVPYEEGQIPAGKCATGPSQMYQFLCSEDEYVD 252 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
antr | NP_001246284.1 | SCP_euk | 63..213 | CDD:240180 | 39/218 (18%) |
XB5812873 | XP_031758624.1 | CAP | 65..201 | CDD:412178 | 29/174 (17%) |
Crisp | 219..269 | CDD:400739 | 18/61 (30%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |