DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment antr and R3hdml

DIOPT Version :9

Sequence 1:NP_001246284.1 Gene:antr / 246647 FlyBaseID:FBgn0050488 Length:272 Species:Drosophila melanogaster
Sequence 2:NP_001092801.1 Gene:R3hdml / 100043899 MGIID:3650937 Length:253 Species:Mus musculus


Alignment Length:196 Identity:44/196 - (22%)
Similarity:78/196 - (39%) Gaps:49/196 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 NYVASGVGNYSVAARMPTMGWDFELQRLADRQVRQCDETGKFCANTDKYHYVATTEIRSKMGRTK 139
            |::.:.|  :..||.|..|.||.:|.|.|:....||..|          |  ..:::...:|:..
Mouse    71 NHIRASV--HPPAANMEYMVWDEQLARSAEAWATQCIWT----------H--GPSQLMKYVGQNL 121

  Fly   140 SLKSAILDKLLPELFLDVMGCMMNSQK---------LVPVREGTCVG----HYMPLIQDHGSRMG 191
            |:.|.....:     :|::......::         ..|.....|.|    ||..::....||:|
Mouse   122 SIHSGRFRSV-----VDLVRSWSEEKRHYSFPAPKDCTPHCPWLCSGPVCSHYTQMVWASSSRLG 181

  Fly   192 C------GLRVKGRDEKESNIILLCHFSRASVNNLV---PYEEGQIPAGKCATGPSQMYQFLCSE 247
            |      .:.|.|...::: :.|:|::  |...|.:   ||:.|: |...|.  ||  ||..|:.
Mouse   182 CAINTCSSINVWGNTWQQA-VYLVCNY--AIKGNWIGEAPYKAGK-PCSACP--PS--YQGNCNS 238

  Fly   248 D 248
            :
Mouse   239 N 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
antrNP_001246284.1 SCP_euk 63..213 CDD:240180 32/156 (21%)
R3hdmlNP_001092801.1 CAP_R3HDML 63..208 CDD:349409 32/158 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841247
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.