DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30487 and Oser1

DIOPT Version :9

Sequence 1:NP_725245.1 Gene:CG30487 / 246646 FlyBaseID:FBgn0050487 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_079975.2 Gene:Oser1 / 66680 MGIID:1913930 Length:291 Species:Mus musculus


Alignment Length:210 Identity:43/210 - (20%)
Similarity:69/210 - (32%) Gaps:83/210 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 FDKSAIEATLDSNKFEDLRIPKHTLKQKFLLRKSIIEHPFKRIRAEGVDWAHKIRDTDEEKESNW 89
            |:......:||.|         ||......||.|::..|               .::..|:.|:.
Mouse   129 FNAGENSTSLDVN---------HTGAAIEPLRSSVLRLP---------------SESKTEELSDA 169

  Fly    90 AKIATGKVSGNAYDLKTMMS---------------ECE----------NICGYGNAINLTVPRVD 129
            .:::...::.|  ||....|               ||:          :..|..|...| .|...
Mouse   170 TQVSQESLTAN--DLSDFQSVSKLSQGKPCVCVGKECQCKRWHDMEVYSFSGLQNVPPL-APERR 231

  Fly   130 KLQDLAKSIPT-----------DPDTVYLTCQCDDIFSNGGTEAPTQSPDEVNFEELSSYFENML 183
            .|:|.::|:.|           :...||:                    |:|..|:|:.|.|..|
Mouse   232 SLEDYSQSLHTRTLSGSPRSCSEQARVYV--------------------DDVTIEDLAGYMEYYL 276

  Fly   184 NIPKNLPLSAEIMYT 198
            .|||.:...||:|||
Mouse   277 YIPKKMSHMAEMMYT 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30487NP_725245.1 None
Oser1NP_079975.2 DUF776 1..175 CDD:368516 12/69 (17%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..139 1/9 (11%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.