DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30487 and Oser1

DIOPT Version :9

Sequence 1:NP_725245.1 Gene:CG30487 / 246646 FlyBaseID:FBgn0050487 Length:198 Species:Drosophila melanogaster
Sequence 2:NP_963854.1 Gene:Oser1 / 296346 RGDID:1303142 Length:291 Species:Rattus norvegicus


Alignment Length:282 Identity:60/282 - (21%)
Similarity:98/282 - (34%) Gaps:91/282 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SIEKISSELRKMIISDNPIEATTFDKSAIEATLDSNKFEDLRIPK-----HTLK--------QKF 53
            :.:|:..:....|:|.:..|.|:. ::::..|:|..|.:.:..||     .|.|        |:.
  Rat    16 AFKKLRVDASGSIVSLSVGEGTSV-RASVRTTVDDTKPKTMCAPKDSWHGSTRKSSRGAVRIQRR 79

  Fly    54 LLRKSIIEHPFKRIRAEGVDWAHKIRDTDEEKESNWAKIATGKVSGNAYDLKTMMSECEN----- 113
            ...||.:.||.|.|...    ......:.:.|:.:..:...|. ||.........|..||     
  Rat    80 RRSKSPVLHPPKFIHCS----TTASPSSSQLKQRSQTEPLDGS-SGRGISTPKEFSTGENSTSLD 139

  Fly   114 ICGYGNAIN------LTVPRVDKLQDLAKSIPTDPDT-----------------------VYLTC 149
            |...|.||.      |.:|...|.::|:.:....|::                       |...|
  Rat   140 INHTGAAIEPLRSSVLRLPSESKTEELSDATQVSPESLTANDLSDFQSVSKLSQGKPCVCVGKAC 204

  Fly   150 QCD-----DIFSNGGTE-----APTQ-----------------SP-----------DEVNFEELS 176
            ||.     :::|..|.:     ||.:                 ||           |:|..|:|:
  Rat   205 QCKRWHDMEVYSFSGLQNVPPLAPERRSLEDYSQSLHTRTLSGSPRSCSEQARVYVDDVTIEDLA 269

  Fly   177 SYFENMLNIPKNLPLSAEIMYT 198
            .|.|..|.|||.:...||:|||
  Rat   270 GYMEYYLYIPKKMSHMAEMMYT 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30487NP_725245.1 None
Oser1NP_963854.1 DUF776 1..175 CDD:368516 34/164 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..139 21/99 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
10.960

Return to query results.
Submit another query.