DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and Pi15

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_444421.2 Gene:Pi15 / 94227 MGIID:1934659 Length:269 Species:Mus musculus


Alignment Length:268 Identity:61/268 - (22%)
Similarity:110/268 - (41%) Gaps:41/268 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLYLLSVLIIVLISQ--EALSTDYCNKDLCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAH 63
            |:...:|.:::|:|.  ||.:....|     |..:.:...|:.|.:.:..:.......|...|..
Mouse    12 MIMNSAVSLVILLSLLCEAHTVVLLN-----PTDSSLPANNFTDTEAALSTPLESADIPKARRKR 71

  Fly    64 ------LLAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEF 122
                  ::|:| |:.|.|....:|   ||:.|..:.|.|.||..|:.....|  |.|:..     
Mouse    72 YISQNDMIAIL-DYHNQVRGKVFP---PAANMEYMVWDENLAKSAEAWAATC--IWDHGP----- 125

  Fly   123 SYVSYIYGSTKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCRG----YFTQLV 183
            ||:....|....::..:.. |:|..| :.|.|:||.....:.....|....:|.|    ::||:|
Mouse   126 SYLLRFLGQNLSVRTGRYR-SILQLV-KPWYDEVKDYAFPYPQDCNPRCPMRCFGPMCTHYTQMV 188

  Fly   184 QDLAAHVGCAMMLRKGQT--SGLYQYGV--LCHFS-RGKIANELVYRASAHPGSRC---YAGTHS 240
            ...:..:|||:...:...  ..:::..|  :|::: :|....|..|:... |.|.|   |.|  :
Mouse   189 WATSNRIGCAIHTCQNMNVWGSVWRRAVYLVCNYAPKGNWIGEAPYKVGV-PCSSCPPSYGG--A 250

  Fly   241 IYEGLCSP 248
            ..:.||.|
Mouse   251 CTDNLCFP 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 39/166 (23%)
Pi15NP_444421.2 SCP_euk 80..223 CDD:240180 38/155 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841284
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.