DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and PRY3

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_012457.1 Gene:PRY3 / 853367 SGDID:S000003614 Length:881 Species:Saccharomyces cerevisiae


Alignment Length:167 Identity:38/167 - (22%)
Similarity:59/167 - (35%) Gaps:47/167 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 ATLRWHEELAGLAKFALRRCDYIDDY-CSNTDEFSYVSYIYGSTKWLQLEKDPISVLDFVLQFWM 153
            |.|.|.:.||..|:      :|.|.| ||..  .::....||..  |.|.......:|    .|.
Yeast    44 APLTWSDTLATYAQ------NYADQYDCSGV--LTHSDGPYGEN--LALGYTDTGAVD----AWY 94

  Fly   154 DDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVGCAMMLRKGQTSGLYQY-------GVLC 211
            .::     :..|...|. ..:..|:|||:|....|.:||.           |:|       .::|
Yeast    95 GEI-----SKYNYSNPG-FSESTGHFTQVVWKSTAEIGCG-----------YKYCGTTWNNYIVC 142

  Fly   212 HFS-----RGKIANE---LVYRASAHPGSRCYAGTHS 240
            .::     .|:.|.|   |:...|:...|.....|.|
Yeast   143 SYNPPGNYLGEFAEEVEPLISTVSSSSSSSSSTSTTS 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 30/131 (23%)
PRY3NP_012457.1 CAP_PRY1-like 24..152 CDD:349403 30/138 (22%)
ser_rich_anae_1 <598..>855 CDD:411418
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344588
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.