DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and PRY1

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_012456.1 Gene:PRY1 / 853366 SGDID:S000003615 Length:299 Species:Saccharomyces cerevisiae


Alignment Length:152 Identity:39/152 - (25%)
Similarity:62/152 - (40%) Gaps:35/152 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LNDFRNTVA----KGQYPHL-RPASRMATLRWHEELAGLAKFALRRCDYIDDY-CSNTDEFSYVS 126
            |:||.::|.    |.:..|. .||     |.|.:.||..|:      ||.|:| ||.|  .::..
Yeast   159 LSDFASSVLAEHNKKRALHKDTPA-----LSWSDTLASYAQ------DYADNYDCSGT--LTHSG 210

  Fly   127 YIYGSTKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVG 191
            ..||..  |.|..|..:.:|    .|.:::     ::.:...|..... .|:|||:|......||
Yeast   211 GPYGEN--LALGYDGPAAVD----AWYNEI-----SNYDFSNPGFSSN-TGHFTQVVWKSTTQVG 263

  Fly   192 CAMMLRKGQTSGLYQYGVLCHF 213
            |.:.    ...|.:...|:|.:
Yeast   264 CGIK----TCGGAWGDYVICSY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 39/152 (26%)
PRY1NP_012456.1 CAP_PRY1-like 166..289 CDD:349403 36/145 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157344546
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.