DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and AT1G50050

DIOPT Version :10

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_175427.1 Gene:AT1G50050 / 841429 AraportID:AT1G50050 Length:226 Species:Arabidopsis thaliana


Alignment Length:60 Identity:19/60 - (31%)
Similarity:28/60 - (46%) Gaps:17/60 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 QCRGYFTQLVQDLAAHVGCAMMLRKGQTSGLYQYGVLCHFSRGKIANELVYRASAHPGSR 233
            ||: ::||:|...:..:|||.:|   ..:|.|..|  |:           |.|||...||
plant   117 QCK-HYTQVVWSNSVKIGCARVL---CNNGGYFVG--CN-----------YDASAALKSR 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 CAP_euk 61..214 CDD:349399 13/39 (33%)
AT1G50050NP_175427.1 CAP_PR-1 27..151 CDD:349400 13/50 (26%)
RlmN <156..183 CDD:440582 2/4 (50%)

Return to query results.
Submit another query.