DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and CRISPLD2

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_113664.1 Gene:CRISPLD2 / 83716 HGNCID:25248 Length:497 Species:Homo sapiens


Alignment Length:303 Identity:68/303 - (22%)
Similarity:105/303 - (34%) Gaps:107/303 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LSVLIIVLISQEALSTDYCNKDLCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAH------ 63
            |.:|.:|..||..|          ||.:|.:              |.::.|: .|..:|      
Human    11 LGLLFLVCGSQGYL----------LPNVTLL--------------EELLSKY-QHNESHSRVRRA 50

  Fly    64 --------LLAVLNDFRNTVAKGQYPHLRP-ASRMATLRWHEELAGLAKFALRRCDYIDDYCSNT 119
                    :|.:.|..|..|        :| ||.|..:.|.:||...|.....:|.:        
Human    51 IPREDKEEILMLHNKLRGQV--------QPQASNMEYMTWDDELEKSAAAWASQCIW-------- 99

  Fly   120 DEFSYVSYIYGSTKWLQLEKDPISVL-----------------DFVLQFWMDDVKGCTMAHINAE 167
                              |..|.|:|                 .|.:|.|.|:||..|..:.:..
Human   100 ------------------EHGPTSLLVSIGQNLGAHWGRYRSPGFHVQSWYDEVKDYTYPYPSEC 146

  Fly   168 KPAKDGQCRG----YFTQLVQDLAAHVGCAM-MLRKGQTSG-LYQYGV--LCHFS-RGKIANELV 223
            .|....:|.|    ::||:|......:|||: ..||....| :::..|  :|::| :|....|..
Human   147 NPWCPERCSGPMCTHYTQIVWATTNKIGCAVNTCRKMTVWGEVWENAVYFVCNYSPKGNWIGEAP 211

  Fly   224 YRASAHPGSRC---YAGTHSIYEGLCSPEEHVNPNALQLGELN 263
            |: :..|.|.|   |.|  |....||..||...|.. :..|:|
Human   212 YK-NGRPCSECPPSYGG--SCRNNLCYREETYTPKP-ETDEMN 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 39/192 (20%)
CRISPLD2NP_113664.1 SCP_euk 56..201 CDD:240180 38/178 (21%)
LCCL 286..370 CDD:128866
LCCL 387..479 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151228
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.