DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and CRISPLD1

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_113649.1 Gene:CRISPLD1 / 83690 HGNCID:18206 Length:500 Species:Homo sapiens


Alignment Length:212 Identity:48/212 - (22%)
Similarity:72/212 - (33%) Gaps:67/212 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 DFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSYIYGSTKW 134
            |..|.:....||   .||.|..:.|..||...|:.....|                       .|
Human    67 DLHNKLRSQVYP---TASNMEYMTWDVELERSAESWAESC-----------------------LW 105

  Fly   135 LQLEKDPISVL-----------------DFVLQFWMDDVKGCTMAHINAEKPAKDGQCRG----Y 178
               |..|.|:|                 .|.:|.|.|:||..:..:.:...|....:|.|    :
Human   106 ---EHGPASLLPSIGQNLGAHWGRYRPPTFHVQSWYDEVKDFSYPYEHECNPYCPFRCSGPVCTH 167

  Fly   179 FTQLVQDLAAHVGCAMMLRK-----GQ--TSGLYQYGVLCHFS-RGKIANELVYRASAHPGSRC- 234
            :||:|...:..:|||:.|..     ||  ...:|   ::|::| :|.......|: ...|.|.| 
Human   168 YTQVVWATSNRIGCAINLCHNMNIWGQIWPKAVY---LVCNYSPKGNWWGHAPYK-HGRPCSACP 228

  Fly   235 --YAGTHSIYEGLCSPE 249
              :.|  ...|.||..|
Human   229 PSFGG--GCRENLCYKE 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 37/171 (22%)
CRISPLD1NP_113649.1 SCP_euk 63..207 CDD:240180 37/171 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 254..281
LCCL 291..375 CDD:128866
LCCL 392..483 CDD:128866
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151165
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.