DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and AT5G66590

DIOPT Version :10

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_201460.1 Gene:AT5G66590 / 836791 AraportID:AT5G66590 Length:185 Species:Arabidopsis thaliana


Alignment Length:139 Identity:28/139 - (20%)
Similarity:53/139 - (38%) Gaps:24/139 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    92 LRWHEELAGLAKFALRRCDYIDDYCSNTDEFSYVSY---IYGSTK-WLQLEKDPISVL-DFVLQF 151
            |.|.:.|...|....|       |..|..:..:.|.   .||:.: |   .|..::|. ...::.
plant    65 LVWSQTLEAAASRLAR-------YQRNQKKCEFASLNPGKYGANQLW---AKGLVAVTPSLAVET 119

  Fly   152 WMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVGCAMMLRKGQTSGLYQYGVLCHFS-R 215
            |   ||.....:..::..|.:..| |.:.|:|...:..:|||......:::.|    .:|.:: .
plant   120 W---VKEKPFYNYKSDTCAANHTC-GVYKQVVWRNSKELGCAQATCTKESTVL----TICFYNPP 176

  Fly   216 GKIANELVY 224
            |.:..:..|
plant   177 GNVIGQKPY 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 CAP_euk 61..214 CDD:349399 26/126 (21%)
AT5G66590NP_201460.1 CAP_PR-1 46..185 CDD:349400 27/137 (20%)

Return to query results.
Submit another query.