DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and AT4G33710

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_195097.1 Gene:AT4G33710 / 829513 AraportID:AT4G33710 Length:166 Species:Arabidopsis thaliana


Alignment Length:203 Identity:43/203 - (21%)
Similarity:69/203 - (33%) Gaps:80/203 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 AIIMKFPMHMRAH-----LLAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFA----- 105
            |:::.|.:.::|.     .|.|.|..|:.|:   .||         ::||   ||.|::|     
plant    16 ALVLAFAVPLKAQDRRQDYLDVHNHARDDVS---VPH---------IKWH---AGAARYAWNYAQ 65

  Fly   106 --LRRCDYIDDYCSNTDEFSYVSYIYGSTKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEK 168
              .|.|..|.......         ||..                |.:...|:.|.....:...:
plant    66 RRKRDCRLIHSNSRGR---------YGEN----------------LAWSSGDMSGAAAVRLWVRE 105

  Fly   169 PA----KDGQCR-----GYFTQLVQDLAAHVGCAMMLRKGQTSGLYQYGVLCHFSRGKIANELVY 224
            .:    |...||     |::||:|...:..||||.:  |....|.:   |.|::|          
plant   106 KSDYFHKSNTCRAGKQCGHYTQVVWKNSEWVGCAKV--KCDNGGTF---VTCNYS---------- 155

  Fly   225 RASAHPGS 232
                |||:
plant   156 ----HPGN 159

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 37/173 (21%)
AT4G33710NP_195097.1 CAP_PR-1 32..166 CDD:349400 40/187 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.