DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and AT4G30320

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_194761.1 Gene:AT4G30320 / 829155 AraportID:AT4G30320 Length:161 Species:Arabidopsis thaliana


Alignment Length:161 Identity:35/161 - (21%)
Similarity:57/161 - (35%) Gaps:33/161 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SCGSEAIIMKFPMHMRAHLLAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKF--ALRR 108
            ||.|.||.....:....|.......|     .|.....|...|:..|:|..:||..|::  ..||
plant     5 SCVSVAITAMMLLVTCCHCATYQEQF-----MGPQNAARAHLRLKPLKWDAKLARYAQWWANQRR 64

  Fly   109 CDYIDDYCSNTDEFSYVSY----IYGS-TKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEK 168
            .|     |:.|  .|...|    .:|| .:|...:         ....|:.:.:.     .|...
plant    65 GD-----CALT--HSNGPYGENLFWGSGNRWGPSQ---------AAYGWLSEARS-----YNYRS 108

  Fly   169 PAKDGQCRGYFTQLVQDLAAHVGCAMMLRKG 199
            .:.:.:..|::||:|......:|||.::..|
plant   109 NSCNSEMCGHYTQIVWKNTQKIGCAHVICNG 139

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 30/146 (21%)
AT4G30320NP_194761.1 CAP_PR-1 27..161 CDD:349400 29/139 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.