DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and AT3G19690

DIOPT Version :10

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_188603.1 Gene:AT3G19690 / 821506 AraportID:AT3G19690 Length:161 Species:Arabidopsis thaliana


Alignment Length:168 Identity:35/168 - (20%)
Similarity:57/168 - (33%) Gaps:59/168 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 YGDFDESCGSEAIIMKFPMHMRAHLLAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAG-LAK 103
            ||...|....:        .:.||     |:.||.|.      |.|      |.|.:|:|. .|.
plant    18 YGSLAEDLQQQ--------FLEAH-----NEARNEVG------LDP------LVWDDEVAAYAAS 57

  Fly   104 FALRR---CDYI-------DDYCSNTDEFSYVSYIYGSTKWLQLEKDPISVLDFVLQFWMDDVKG 158
            :|.:|   |..:       ::...::.|.|...   .:..|:. ||          |::..|...
plant    58 YANQRINDCALVHSNGPFGENIAMSSGEMSAED---AAEMWIN-EK----------QYYDYDSNT 108

  Fly   159 CTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVGCAMML 196
            |        .....|.|. ::||:|......:|||.::
plant   109 C--------NDPNGGTCL-HYTQVVWKNTVRLGCAKVV 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 CAP_euk 61..214 CDD:349399 32/147 (22%)
AT3G19690NP_188603.1 CAP_PR-1 26..161 CDD:349400 32/160 (20%)

Return to query results.
Submit another query.