DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and AT2G19980

DIOPT Version :10

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_179588.1 Gene:AT2G19980 / 816517 AraportID:AT2G19980 Length:165 Species:Arabidopsis thaliana


Alignment Length:128 Identity:32/128 - (25%)
Similarity:49/128 - (38%) Gaps:34/128 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 LRPASRMATLRWHEELA----------GLAKFALRRCDYIDDYCS---NTDEFSYVSYIYG---S 131
            ||..|||..|:..|.||          .||..|.|..:.....|:   :||.      .||   :
plant    24 LRSFSRMDDLQPAETLAVHNQIRAADQKLAAHAQRYANVRSQDCAMKYSTDG------TYGENIA 82

  Fly   132 TKWLQLEKDPISVLD--FVLQFWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVGC 192
            ..|:|    |:..:.  ...:||..:......|.....:|.      |::||:|.:.:.|:||
plant    83 AGWVQ----PMDTMSGPIATKFWFTEKPYYNYATNKCSEPC------GHYTQIVANQSTHLGC 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 CAP_euk 61..214 CDD:349399 32/128 (25%)
AT2G19980NP_179588.1 CAP_PR-1 35..165 CDD:349400 26/117 (22%)

Return to query results.
Submit another query.