DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and PRB1

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_179064.1 Gene:PRB1 / 815945 AraportID:AT2G14580 Length:161 Species:Arabidopsis thaliana


Alignment Length:179 Identity:33/179 - (18%)
Similarity:62/179 - (34%) Gaps:63/179 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 HMRAHLLAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLA-----------KFALRRCDYI 112
            ::.||     |..|:.:..|            .::|.|.||..|           :....|..|.
plant    33 YVNAH-----NQARSQIGVG------------PMQWDEGLAAYARNYANQLKGDCRLVHSRGPYG 80

  Fly   113 DDYCSNTDEFSYVSYIYGSTKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCRG 177
            ::...:..:.|.|:                     .:..|:::     .|:.|.:....:|.| |
plant    81 ENLAKSGGDLSGVA---------------------AVNLWVNE-----KANYNYDTNTCNGVC-G 118

  Fly   178 YFTQLVQDLAAHVGCA-MMLRKGQTSGLYQYGVLCHFS-RGKIANELVY 224
            ::||:|...:..:||| :....|.|.      :.|::. .|..||:..|
plant   119 HYTQVVWRNSVRLGCAKVRCNNGGTI------ISCNYDPPGNYANQKPY 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 29/164 (18%)
PRB1NP_179064.1 CAP_PR-1 30..161 CDD:349400 32/177 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.