DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and Crispld2

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001297564.1 Gene:Crispld2 / 78892 MGIID:1926142 Length:495 Species:Mus musculus


Alignment Length:242 Identity:60/242 - (24%)
Similarity:85/242 - (35%) Gaps:76/242 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 PMHMRAHLLAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSNTDE 121
            ||..|..:|.:.|..|..|    ||   |||.|..:.|.|||...|.....||            
Mouse    52 PMSDRQEILMLHNKLRGQV----YP---PASNMEHMTWDEELERSAAAWAHRC------------ 97

  Fly   122 FSYVSYIYGSTKWLQLEKDPISVL-----------------DFVLQFWMDDVKGCTMAHINAEKP 169
                       .|   |..|..:|                 .|.:|.|.|:||..|..:.:...|
Mouse    98 -----------LW---EHGPAGLLRSIGQNLAVHWGRYRSPGFHVQSWYDEVKDYTYPYPHECTP 148

  Fly   170 AKDGQCRG----YFTQLVQDLAAHVGCAM-----MLRKGQT--SGLYQYGVLCHFS-RGKIANEL 222
            ....:|.|    ::||:|......:|||:     |...|.|  :.:|   ::|::| :|....|.
Mouse   149 RCRERCSGPMCTHYTQMVWATTNKIGCAVHTCRNMNVWGDTWENAVY---LVCNYSPKGNWIGEA 210

  Fly   223 VYRASAHPGSRC---YAGTHSIYEGLC----SPEEHVNPNALQLGEL 262
            .|: ...|.|.|   |.|  .....||    .|.:| .|....:.|:
Mouse   211 PYK-HGRPCSECPSSYGG--GCLNNLCHRAEKPHKH-KPEVDMMNEV 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 43/180 (24%)
Crispld2NP_001297564.1 CAP 56..201 CDD:381818 43/180 (24%)
LCCL 284..368 CDD:128866
LCCL 387..486 CDD:367672
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841305
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.