Sequence 1: | NP_725234.2 | Gene: | CG30486 / 246645 | FlyBaseID: | FBgn0050486 | Length: | 263 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_076223.3 | Gene: | Pi16 / 74116 | MGIID: | 1921366 | Length: | 498 | Species: | Mus musculus |
Alignment Length: | 205 | Identity: | 45/205 - (21%) |
---|---|---|---|
Similarity: | 77/205 - (37%) | Gaps: | 53/205 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 69 NDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDY---------IDDYCSNTDEFSY 124
Fly 125 VSYIYGSTKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKD-GQCRGYFTQLVQDLAA 188
Fly 189 HVGCAM----MLRKGQTSGLYQYGVLCHFS-RGKIANELVYRASAHPGSRCYAGTHSIYEGLCSP 248
Fly 249 EEHVNPNALQ 258 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG30486 | NP_725234.2 | SCP_euk | 61..214 | CDD:240180 | 32/158 (20%) |
Pi16 | NP_076223.3 | SCP_HrTT-1 | 35..168 | CDD:240186 | 32/158 (20%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 204..277 | 3/6 (50%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 317..407 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 419..467 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG2340 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1528782at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
4 | 3.780 |