DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and Pi16

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_076223.3 Gene:Pi16 / 74116 MGIID:1921366 Length:498 Species:Mus musculus


Alignment Length:205 Identity:45/205 - (21%)
Similarity:77/205 - (37%) Gaps:53/205 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 NDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDY---------IDDYCSNTDEFSY 124
            |.:|..|:.       |||.|..:||.:|||..||...::|.:         .::..:.|||...
Mouse    43 NQYRAQVSP-------PASDMLQMRWDDELAAFAKAYAQKCVWGHNKERGRRGENLFAITDEGMD 100

  Fly   125 VSYIYGSTKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKD-GQCRGYFTQLVQDLAA 188
            |....|:                    |.::.:     :.|......| .|..|::||:|.....
Mouse   101 VPLAVGN--------------------WHEEHE-----YYNFSTATCDPNQMCGHYTQVVWSKTE 140

  Fly   189 HVGCAM----MLRKGQTSGLYQYGVLCHFS-RGKIANELVYRASAHPGSRCYAGTHSIYEGLCSP 248
            .:||..    .|:..:.:.::.  ::|::. .|.:.....|:... |.|:|..| :|....||.|
Mouse   141 RIGCGSHFCETLQGVEEANIHL--LVCNYEPPGNVKGRKPYQEGT-PCSQCPLG-YSCENSLCEP 201

  Fly   249 EEHVNPNALQ 258
            ..  ||...|
Mouse   202 MR--NPEKAQ 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 32/158 (20%)
Pi16NP_076223.3 SCP_HrTT-1 35..168 CDD:240186 32/158 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 204..277 3/6 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 317..407
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 419..467
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.