DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and CRISP2

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:XP_005249406.1 Gene:CRISP2 / 7180 HGNCID:12024 Length:278 Species:Homo sapiens


Alignment Length:215 Identity:46/215 - (21%)
Similarity:76/215 - (35%) Gaps:53/215 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLSVLIIVLISQEALSTDYCNKDLCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAHLLAVL 68
            ||.||.:|.:...:|..:  .||   |..|                  .::...:.::..::...
Human     3 LLPVLFLVTVLLPSLPAE--GKD---PAFT------------------ALLTTQLQVQREIVNKH 44

  Fly    69 NDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRC--DYIDDYCSNTDEFSYVSYIYGS 131
            |:.|..|:.       |||.|..:.|..|:...|:....:|  .:.|.....|           |
Human    45 NELRKAVSP-------PASNMLKMEWSREVTTNAQRWANKCTLQHSDPEDRKT-----------S 91

  Fly   132 TKW---LQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVGCA 193
            |:.   |.:..||.| ....:|.|.|::    :..:....|.......|::||||......|||.
Human    92 TRCGENLYMSSDPTS-WSSAIQSWYDEI----LDFVYGVGPKSPNAVVGHYTQLVWYSTYQVGCG 151

  Fly   194 MMLRKGQTSGLYQYGVLCHF 213
            :.....|.|..|.|  :|.:
Human   152 IAYCPNQDSLKYYY--VCQY 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 36/158 (23%)
CRISP2XP_005249406.1 SCP_CRISP 35..172 CDD:240183 36/160 (23%)
Crisp 224..278 CDD:285731
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151291
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I5480
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.