DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and Glipr1l1

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_081294.1 Gene:Glipr1l1 / 69286 MGIID:1916536 Length:236 Species:Mus musculus


Alignment Length:200 Identity:48/200 - (24%)
Similarity:82/200 - (41%) Gaps:36/200 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LAVLNDFRNTVAKGQYPHLRPASRMATLRWHEELAGLAKFALRRCDYIDDYCSN-----TDEFSY 124
            |.:.|:.|..|..       ||:.|..|.|.::||.|||...|.|....:.|..     .:::.:
Mouse    46 LNIHNELRRKVQP-------PAADMNQLFWDQQLAKLAKAWTRECKLAHNPCIKQRYECLEDYDF 103

  Fly   125 VSYIYGSTKWL-QLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAA 188
            :    |...:| ::|..|   .|.|:. |.::.|     :.|.:.......| |::||:|.....
Mouse   104 I----GENIYLGRIETQP---EDVVIN-WYNESK-----YFNFDFNTCSEMC-GHYTQVVWAKTV 154

  Fly   189 HVGCAMM---LRKGQTSGLYQYGVLCHFSRGKIANELVYRASAHPGSRCYAGTHSIYEGLCSPEE 250
            .:|||:.   ..||.::||:    :|::|  ...|.:.:|......|....|..:....||.|..
Mouse   155 KIGCAVSNCPNLKGFSAGLF----VCNYS--PAGNFIGFRPYTRGDSCSMCGQKTCENSLCRPMN 213

  Fly   251 HVNPN 255
            ...|:
Mouse   214 RKTPH 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 39/157 (25%)
Glipr1l1NP_081294.1 SCP_GLIPR-1_like 40..181 CDD:240185 40/161 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841408
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 75 1.000 Inparanoid score I5254
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.800

Return to query results.
Submit another query.