DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and Crisp3

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_074050.1 Gene:Crisp3 / 64827 RGDID:619846 Length:246 Species:Rattus norvegicus


Alignment Length:263 Identity:57/263 - (21%)
Similarity:95/263 - (36%) Gaps:50/263 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLYLLSVLIIVLISQEALSTDYCNKDLCLPEITHIACRNYGDFDESCGSEAIIMKFPMHMRAHLL 65
            :|:|.:||...|:..   :||..::||.....|.::.:           |.||.|.         
  Rat     7 LLFLAAVLPPSLLQD---TTDEWDRDLENLSTTKLSVQ-----------EEIINKH--------- 48

  Fly    66 AVLNDFRNTVAKGQYPHLRPASRMATLRW-HEELAGLAKFALRRCDYIDDYCSNTDEFSYVSYIY 129
               |..|.||:..       .|.:..:.| |:......|:| .||.|      |.....:.:...
  Rat    49 ---NQLRRTVSPS-------GSDLLRVEWDHDAYVNAQKWA-NRCIY------NHSPLQHRTTTL 96

  Fly   130 GSTKWLQLEKDPISVLDFVLQFWMDDVKGCTMAHINAEKPAKDGQCRGYFTQLVQDLAAHVGCAM 194
            ...:.|.:...|.| ...|:|.|.|:    ::..:....|.|.|...|::||:|.:....|.|.:
  Rat    97 KCGENLFMANYPAS-WSSVIQDWYDE----SLDFVFGFGPKKVGVKVGHYTQVVWNSTFLVACGV 156

  Fly   195 MLRKGQTSGLYQYGVLCHFSRGKIANELVYRASAHPGSRCYAGTHSIYEGLCSPEEHVNPNALQL 259
            .....|.   .:|..:||:..|......:|..... |..|.:...:..:|||:.......|....
  Rat   157 AECPDQP---LKYFYVCHYCPGGNYVGRLYSPYTE-GEPCDSCPGNCEDGLCTNSCEYEDNYSNC 217

  Fly   260 GEL 262
            |:|
  Rat   218 GDL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 33/153 (22%)
Crisp3NP_074050.1 SCP_CRISP 39..174 CDD:240183 37/179 (21%)
Crisp 192..246 CDD:285731 7/29 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344828
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG2340
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.