DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG30486 and crispld2

DIOPT Version :9

Sequence 1:NP_725234.2 Gene:CG30486 / 246645 FlyBaseID:FBgn0050486 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001027499.1 Gene:crispld2 / 613091 XenbaseID:XB-GENE-985953 Length:500 Species:Xenopus tropicalis


Alignment Length:242 Identity:53/242 - (21%)
Similarity:91/242 - (37%) Gaps:70/242 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 VLNDFRNTVAKGQYPHLRPASRMATLR--------WHEELAGLAKFALRRCDYI--DDYCSNTDE 121
            :||.:::|.     ||.|  :|.|.||        .|.:|.|....:....:|:  ||....:.|
 Frog    35 LLNKYKDTT-----PHSR--TRRAILRTDKEEIIQLHNKLRGQVHPSASNMEYMTWDDELEKSAE 92

  Fly   122 FSYVSYIYGSTKWLQ---LEKDPISVL-----------------DFVLQFWMDDVKGCTMAHINA 166
                       .|.:   .|..|.::|                 .:.:|.|.|:||..|..:.:.
 Frog    93 -----------AWAEECIWEHGPTALLMSIGQNLAVHWGRYRQPAYHVQSWYDEVKDYTYPYPHE 146

  Fly   167 EKPAKDGQCRG----YFTQLVQDLAAHVGCAMMLRKGQT-------SGLYQYGVLCHFS-RGKIA 219
            ..|....:|.|    ::||:|......||||:.:.|...       :.:|   ::|::| :|...
 Frog   147 CNPYCPERCSGPMCTHYTQIVWATTTKVGCAVNVCKRMNVWGDIWENAVY---LVCNYSPKGNWI 208

  Fly   220 NELVYRASAHPGSRC---YAGTHSIYEGLC-SPEEHVNPNALQLGEL 262
            .|..|: :..|.|.|   |.|  :....|| ..::|.....:...|:
 Frog   209 GEAPYK-NGRPCSECPPSYGG--NCQNNLCYKGDKHYGREGIVTNEV 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG30486NP_725234.2 SCP_euk 61..214 CDD:240180 40/187 (21%)
crispld2NP_001027499.1 SCP_euk 57..202 CDD:240180 30/158 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 260..281
LCCL 289..373 CDD:128866
LCCL 392..490 CDD:281766
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1528782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.